PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00123.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 596aa    MW: 64102.2 Da    PI: 9.8065
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00123.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box223.4e-07290327440
                      zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40 
                                   r C  ++  ++  +C++++ +lC+ C    H +  H++v
  Zmw_sc00123.1.g00040.1.am.mk 290 RQCGACGGTPAAVHCRTDGAYLCAGCDAG-HARagHERV 327
                                   68**************************9.977889875 PP

2CCT69.49.3e-24523566144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k++
  Zmw_sc00123.1.g00040.1.am.mk 523 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRT 566
                                   9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.9E-5287329IPR000315B-box-type zinc finger
CDDcd000215.70E-6290329No hitNo description
PROSITE profilePS501198.674292329IPR000315B-box-type zinc finger
PfamPF062038.3E-18523565IPR010402CCT domain
PROSITE profilePS5101716.956523565IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MVSRPATRRR RKPSARTRSS LNRERYLFRS APPRWMGYTY PYPYPPPAGH PQSNLLHCML  60
ARSSVTAGLA EDALRGDVAG PGTRARFWQA KDTPEPEAAP RRTGSRARRR CPSARYDGIA  120
FVTRPALPDE LAVPSAAGHA TSRTAVAADM PSKLVVYFAW PGRDGYRLLQ RSPLASSSSP  180
RHPCPHHSLS VSPTSRIHHF FLAIDLFGNS FLGKFSTRGA RTGQRHDIIT HPYGDHQEAT  240
AARGLVQLRF ACWWTLPLGA SSLPLIGWRS KPRQVQVREE LGRYWGVGGR QCGACGGTPA  300
AVHCRTDGAY LCAGCDAGHA RAGHERVWVC EPIGSSTDAD ELLLGAAGDH DVVFGGGAWN  360
DAAEAGMVLR GAGDAKQDAK MDLFTFADVM DPFLGPEVAR FPLQADSVVP NDGSGGGAVE  420
LDFGGAVAAN ARPSYSSYMA ASVAHSGSSS EVGLVPDAIC GHGGSVTGGV IELDFAQSKA  480
AYIPYATTPT THSVPSLDTG AVPERSDGVA AGKVAAPATA ESREARLMRY REKRKNRRFE  540
KTIRYASRKA YAETRPRVKG RFAKRTTDGT EEIAPPRQPA YPYVLDFSGY GVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645312.11e-102PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
TrEMBLF2DTK11e-105F2DTK1_HORVD; Predicted protein
STRINGMLOC_38289.31e-105(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348